PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3DL_1E9DECCEA.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family E2F/DP
Protein Properties Length: 162aa    MW: 18945.8 Da    PI: 10.4681
Description E2F/DP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3DL_1E9DECCEA.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1E2F_TDP46.46.7e-159413871
                E2F_TDP 38 dvknkrRRiYDilNVLealnliekkekneirwkg 71
                           d+kn+rRR+YD++NVL al++i+k ek+eirw+g
  Traes_3DL_1E9DECCEA.1  9 DEKNIRRRVYDAFNVLIALRVIAK-EKKEIRWMG 41
                           789*********************.*******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM013720.0036141IPR003316E2F/DP family, winged-helix DNA-binding domain
SuperFamilySSF467851.36E-10542IPR011991Winged helix-turn-helix DNA-binding domain
Gene3DG3DSA:1.10.10.102.7E-18646IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF023197.0E-12641IPR003316E2F/DP family, winged-helix DNA-binding domain
CDDcd144588.23E-2646145IPR014889Transcription factor DP, C-terminal
SuperFamilySSF1440743.92E-3348158No hitNo description
SMARTSM011383.2E-2448161IPR014889Transcription factor DP, C-terminal
PfamPF087811.8E-2449146IPR014889Transcription factor DP, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MAHIGQGFDE KNIRRRVYDA FNVLIALRVI AKEKKEIRWM GLSNYRYEKI KKLEEVRKEH  60
VNKIRNKKAL LQEIEKQFDD LQNIMLRNQT LESSAENVNG IRLPFVLVKT SRKARVEIEI  120
SDDSKFAHFE FNGAPFTLHD DLSILEGIRR NSIGRAGRAT LH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2719170.0AJ271917.1 Triticum sp. mRNA for DP protein (dp gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014754350.15e-93PREDICTED: transcription factor-like protein DPB
TrEMBLW5D8C41e-115W5D8C4_WHEAT; Uncharacterized protein
STRINGOB01G35630.12e-83(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP128338109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03415.27e-42Transcription factor DP
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]